Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence55.22%DateWed Jan 25 15:20:41 GMT 2012
Rank54Aligned Residues25
% Identity28%Templatec3d1lB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:putative nadp oxidoreductase bf3122; PDBTitle: crystal structure of putative nadp oxidoreductase bf3122 from2 bacteroides fragilis
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30..
Predicted Secondary structure 












Query SS confidence 































Query Sequence  MSEQRVVVMGLGNLLWADEGFGVRVAERLYAH
Query Conservation 

 









 
 





  
   
   
Alig confidence 












.......











Template Conservation      

 


 
 .......

  

  
   
Template Sequence  IEDTPIVLIGAGN. . . . . . . LATNLAKALYRK
Template Known Secondary structure  GGG


S.......T
Template Predicted Secondary structure 







.......
Template SS confidence 































   5....10....... ..20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions