Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence50.10%DateWed Jan 25 15:20:41 GMT 2012
Rank75Aligned Residues33
% Identity24%Templatec2xdoC_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:tetx2 protein; PDBTitle: structure of the tetracycline degrading monooxygenase tetx2 from2 bacteroides thetaiotaomicron
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40...
Predicted Secondary structure 


















Query SS confidence 










































Query Sequence  MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVD
Query Conservation 

 









 
 





  
   
      
  
 


Alig confidence 













.......












...





Template Conservation 
   

 




 
.......

  
  

  
 ... 
 


Template Sequence  LSDKNVAIIGGGPV. . . . . . . GLTMAKLLQQNGI. . . DVSVYE
Template Known Secondary structure 
TT


S.......TTT
...
Template Predicted Secondary structure 







.......


...
Template SS confidence 










































   14.....20....... ..30.........40 ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions