Return to main results Retrieve Phyre Job Id

Job DescriptionP19930
Confidence46.68%DateWed Jan 25 15:20:41 GMT 2012
Rank88Aligned Residues32
% Identity28%Templatec2uyyD_
PDB info PDB header:cytokineChain: D: PDB Molecule:n-pac protein; PDBTitle: structure of the cytokine-like nuclear factor n-pac
Resolution2.5 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40...
Predicted Secondary structure 

















Query SS confidence 









































Query Sequence  SEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVD
Query Conservation 
 









 
 





  
   
      
  
 


Alig confidence 











.......













...





Template Conservation     

 




 .......

  

  
   
 ... 
   
Template Sequence  TDKKIGFLGLGL. . . . . . . MGSGIVSNLLKMGH. . . TVTVWN
Template Known Secondary structure 
SS

S.......TT
...
Template Predicted Secondary structure 





.......


...
Template SS confidence 









































   266...270....... ..280.........290. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions