Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB55
Confidence2.39%DateThu Jan 5 11:14:41 GMT 2012
Rank80Aligned Residues24
% Identity8%Templated1o20a_
SCOP infoALDH-like ALDH-like ALDH-like
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.........80
Predicted Secondary structure 






















Query SS confidence 







































Query Sequence  GPMPAVDSNDPGAAGFTGSTVIAEFESLEAAQAWADADPY
Query Conservation 

               

  
  
 
 


   
  


Alig confidence 


................




















Template Conservation 


................
 
      



  

    
Template Sequence  DLI. . . . . . . . . . . . . . . . IAIKVVKNVDEAIEHIKKYST
Template Known Secondary structure  SS................SS

Template Predicted Secondary structure 

................





Template SS confidence 







































   313.. ....320.........330......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions