Return to main results Retrieve Phyre Job Id

Job DescriptionP64467
Confidence4.94%DateThu Jan 5 12:08:38 GMT 2012
Rank55Aligned Residues27
% Identity26%Templatec1zaxU_
PDB info PDB header:structural proteinChain: U: PDB Molecule:50s ribosomal protein l7/l12; PDBTitle: ribosomal protein l10-l12(ntd) complex, space group p212121,2 form b
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.
Predicted Secondary structure 









Query SS confidence 











































Query Sequence  SLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQ
Query Conservation 




 
     
    
      




 


 
  



  
Alig confidence 















.............




..




..
Template Conservation 
  


 


 


 
.............




..
 


..
Template Sequence  TIDEIIEAIEKLTVSE. . . . . . . . . . . . . LAELV. . KKLED. . K
Template Known Secondary structure 
S
.................
Template Predicted Secondary structure 
.................
Template SS confidence 











































   2.......10....... ..20.. ..... .
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions