Return to main results Retrieve Phyre Job Id

Job DescriptionP77453
Confidence3.42%DateThu Jan 5 12:29:24 GMT 2012
Rank88Aligned Residues24
% Identity33%Templated2cpqa1
SCOP infoEukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I) Eukaryotic type KH-domain (KH-domain type I)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.
Predicted Secondary structure 









Query SS confidence 





























Query Sequence  TLRKKFVASSDEMPEHSSQVMYYSLAIGHH
Query Conservation   
 




   


 




 








Alig confidence 










.




.....







Template Conservation 
  
   


 .
   
.....





  
Template Sequence  QLAAAFHEEFV. VREDL. . . . . MGLAIGTH
Template Known Secondary structure  SSS
S.

.....TTT
Template Predicted Secondary structure 



.
.....


Template SS confidence 





























   214.....220.... ..... 230.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions