Return to main results Retrieve Phyre Job Id

Job DescriptionP15877
Confidence36.43%DateThu Jan 5 11:34:57 GMT 2012
Rank96Aligned Residues53
% Identity17%Templatec1bpoA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:protein (clathrin); PDBTitle: clathrin heavy-chain terminal domain and linker
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   224.....230.........240.........250.........260.........270.........280.........290.... .....300
Predicted Secondary structure 












































...


Query SS confidence 






































































. . .





Query Sequence  GDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPEVMADCPRRIILPV. . . NDGRLI
Query Conservation 

 


 
    
 



 


 

                 



              
    

   
... 

 
 
Alig confidence 




























.................................








...





Template Conservation   







 
     
  
 
 
   

.................................
 
 


      
 

 
Template Sequence  HDVVFLITKYGYIHLYDLETGTCIYMNRI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SGETIFVTAPHEATAGII
Template Known Secondary structure  TTTTSTTT


.................................
SS
TTTT
Template Predicted Secondary structure 











.................................









Template SS confidence 















































































   270.........280.........290........ .300.........310......
 
   301........310
Predicted Secondary structure 




Query SS confidence 









Query Sequence  AINAENGKLC
Query Conservation 



 

   
Alig confidence 


.





Template Conservation   

.
 
 
 
Template Sequence  GVN. RKGQVL
Template Known Secondary structure  .TT
Template Predicted Secondary structure 
.

Template SS confidence 









   317.. 320.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions