Return to main results Retrieve Phyre Job Id

Job DescriptionP75958
Confidence8.48%DateThu Jan 5 12:16:27 GMT 2012
Rank35Aligned Residues55
% Identity9%Templatec3fewX_
PDB info PDB header:immune systemChain: X: PDB Molecule:colicin s4; PDBTitle: structure and function of colicin s4, a colicin with a2 duplicated receptor binding domain
Resolution2.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   317..320.........330.........340.........350.........360.........370.........380.........390......
Predicted Secondary structure 














Query SS confidence 















































































Query Sequence  AIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASW
Query Conservation       
         


  

      
                             
                 
   
Alig confidence 





























..........................























Template Conservation 





























..........................



 


















Template Sequence  LMLEVESWVLSGIASAVALGVFSATLGAYA. . . . . . . . . . . . . . . . . . . . . . . . . . LSLGAPAIAVGIVGILLAAVVGAL
Template Known Secondary structure  TT

..........................

S
SS
Template Predicted Secondary structure  ..........................
Template SS confidence 















































































   428.430.........440.........450....... ..460.........470.........480.
 
   397
Predicted Secondary structure 
Query SS confidence 
Query Sequence  Y
Query Conservation   
Alig confidence 
Template Conservation 
Template Sequence  L
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   482
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions