Return to main results Retrieve Phyre Job Id

Job DescriptionP75838
Confidence8.82%DateThu Jan 5 12:14:52 GMT 2012
Rank79Aligned Residues24
% Identity38%Templatec2qm2B_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:putative hopj type iii effector protein; PDBTitle: putative hopj type iii effector protein from vibrio parahaemolyticus
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   407..410.........420.........430.........440.........
Predicted Secondary structure 






Query SS confidence 










































Query Sequence  GSHLRETILSLPGSEWEKEDYLNLIEQLDEEGFDDFTRVRELL
Query Conservation 
                                          
Alig confidence 











....


...............








Template Conservation 
  

 


  
.... 
 ...............

 


 

Template Sequence  GRFYREDVLLHP. . . . ENN. . . . . . . . . . . . . . . DHQNIRNFX
Template Known Secondary structure  TTTTT
T....T

...............

Template Predicted Secondary structure 

....


...............
Template SS confidence 










































   82.......90... ... ...100.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions