Return to main results Retrieve Phyre Job Id

Job DescriptionP0A780
Confidence3.05%DateThu Jan 5 11:05:01 GMT 2012
Rank57Aligned Residues51
% Identity14%Templatec2zihC_
PDB info PDB header:protein transportChain: C: PDB Molecule:vacuolar protein sorting-associated protein 74; PDBTitle: crystal structure of yeast vps74
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.........70....
Predicted Secondary structure 











Query SS confidence 





































































Query Sequence  ARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLMKPYLSRLL
Query Conservation   
  

  
   
             
        
   
      

 

      

  
   
    
Alig confidence 















.......




















............













Template Conservation       
 
 
   
  .......  



    
       
  ............     
        
Template Sequence  SFKIIRTLALICGSYG. . . . . . . ANVLENVLTTLEYEKRDKAIS. . . . . . . . . . . . RAEEIMAQFSQYPF
Template Known Secondary structure  TT.......TT
GGGGGSSS
............TSSS
Template Predicted Secondary structure  .......


............




Template SS confidence 





































































   246...250.........260. ........270.........280.. .......290......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions