Return to main results Retrieve Phyre Job Id

Job DescriptionP37349
Confidence48.02%DateThu Jan 5 11:55:28 GMT 2012
Rank65Aligned Residues29
% Identity24%Templatec4a1eF_
PDB info PDB header:ribosomeChain: F: PDB Molecule:rpl7a; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna, 5.8s rrna3 and proteins of molecule 1
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   398.400.........410.........420.........430.........440....
Predicted Secondary structure 















Query SS confidence 














































Query Sequence  ILLAENIYPSTVLQLDPAVVKGICLSAGSPVSHSALIARELGIGWIC
Query Conservation 



 





 
 

   
 



  

 
















Alig confidence 











..................
















Template Conservation 



 






..................
 


 

 
  


  
Template Sequence  VVIAHDVDPIEL. . . . . . . . . . . . . . . . . . VIFLPQLCRKNDVPFAF
Template Known Secondary structure  S

SST..................TT

Template Predicted Secondary structure 



..................



Template SS confidence 














































   144.....150..... ....160.........170..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions