Return to main results Retrieve Phyre Job Id

Job DescriptionP37349
Confidence43.85%DateThu Jan 5 11:55:28 GMT 2012
Rank73Aligned Residues29
% Identity28%Templatec2zkrf_
PDB info PDB header:ribosomal protein/rnaChain: F: PDB Molecule:rna expansion segment es7 part iii; PDBTitle: structure of a mammalian ribosomal 60s subunit within an2 80s complex obtained by docking homology models of the rna3 and proteins into an 8.7 a cryo-em map
Resolution8.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   398.400.........410.........420.........430.........440....
Predicted Secondary structure 















Query SS confidence 














































Query Sequence  ILLAENIYPSTVLQLDPAVVKGICLSAGSPVSHSALIARELGIGWIC
Query Conservation 



 





 
 

   
 



  

 
















Alig confidence 











..................
















Template Conservation 



 

 
   ..................
 


 

    


  
Template Sequence  VVIAHDVDPIEL. . . . . . . . . . . . . . . . . . VVFLPALCRKMGVPYCI
Template Known Secondary structure  S

SSSTT..................TTT

Template Predicted Secondary structure 



..................



Template SS confidence 














































   155....160...... ...170.........180...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions