Return to main results Retrieve Phyre Job Id

Job DescriptionQ9JMS1
Confidence2.76%DateThu Jan 5 12:37:56 GMT 2012
Rank72Aligned Residues20
% Identity15%Templated1liaa_
SCOP infoGlobin-like Globin-like Phycocyanin-like phycobilisome proteins
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20..... ....30.... .....
Predicted Secondary structure 
..............
Query SS confidence 





. .








. . . . . . . . . . . .




Query Sequence  RLEDLW. . FSWYFRYIH. . . . . . . . . . . . DRCLR
Query Conservation 





..








............




Alig confidence 





..








............




Template Conservation 
   
 

    

 








   
    
 
Template Sequence  KINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIA
Template Known Secondary structure  TSSTTT
Template Predicted Secondary structure 






Template SS confidence 

































   80.........90.........100.........110...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions