Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADU7
Confidence3.01%DateThu Jan 5 11:21:53 GMT 2012
Rank61Aligned Residues24
% Identity25%Templatec2awyB_
PDB info PDB header:oxygen storage/transportChain: B: PDB Molecule:hemerythrin-like domain protein dcrh; PDBTitle: met-dcrh-hr
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   112.......120...... ...130.....
Predicted Secondary structure  ............



Query SS confidence 














. . . . . . . . . . . .








Query Sequence  RDEKHQINQFLADWL. . . . . . . . . . . . RYCLAHGAM
Query Conservation   


 


 

 


............  

 

  
Alig confidence 














............








Template Conservation            
  

  

   
      
   


Template Sequence  PEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Template Known Secondary structure  TTTTT

Template Predicted Secondary structure 



Template SS confidence 



































   101........110.........120.........130......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions