Return to main results Retrieve Phyre Job Id

Job DescriptionP77202
Confidence97.38%DateThu Jan 5 12:26:16 GMT 2012
Rank154Aligned Residues88
% Identity17%Templatec3lgcA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:glutaredoxin 1; PDBTitle: crystal structure of glutaredoxin 1 from francisella2 tularensis
Resolution2.77 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   113......120.........130.........140.........150.........160.........170.........180.........190..
Predicted Secondary structure 




























Query SS confidence 















































































Query Sequence  DAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPA
Query Conservation   
   
 




 



      
      
 
 
     
     
   
  
 

 
   
                 
Alig confidence 



















....



























............................
Template Conservation    
 

 


   

 
  
....
  
    
 
    
            ............................
Template Sequence  SNAXKVKIYTRNGCPYCVWA. . . . KQWFEENNIAFDETIIDDYAQRSKFYDE. . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure 

S


TT
....TT





............................
Template Predicted Secondary structure 







....










............................
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions