Return to main results Retrieve Phyre Job Id

Job DescriptionP45423
Confidence91.86%DateThu Jan 5 12:02:36 GMT 2012
Rank3Aligned Residues42
% Identity19%Templatec1w36E_
PDB info PDB header:recombinationChain: E: PDB Molecule:exodeoxyribonuclease v beta chain; PDBTitle: recbcd:dna complex
Resolution3.1 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   267..270.........280.........290 .........300.........310
Predicted Secondary structure 








.................
Query SS confidence 























. . . . . . . . . . . . . . . . .



















Query Sequence  RVDLLFFHRRLRCLLIVDLKVGKF. . . . . . . . . . . . . . . . . SYSDAGQMNMYLNYAKEHWT
Query Conservation   






  
 
 
 



  

................. 

  


  

   
   
Alig confidence 







..













.................



















Template Conservation   

 
   .. 
   






 

     
    
        
 

  

  

 
 
 
Template Sequence  FIDLVFRH. . EGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLR
Template Known Secondary structure  S..SS





SSGGGSBTTT
Template Predicted Secondary structure  ..
















Template SS confidence 




























































   1065....1070.. .......1080.........1090.........1100.........1110.........1120...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions