Return to main results Retrieve Phyre Job Id

Job DescriptionP00934
Confidence21.31%DateThu Jan 5 10:57:12 GMT 2012
Rank148Aligned Residues39
% Identity15%Templatec2xa0A_
PDB info PDB header:apoptosisChain: A: PDB Molecule:apoptosis regulator bcl-2; PDBTitle: crystal structure of bcl-2 in complex with a bax bh32 peptide
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   186...190.........200.........210.........220.........230.......
Predicted Secondary structure 














Query SS confidence 



















































Query Sequence  FDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQET
Query Conservation 


 
  

    
        
 
 



  

 

 
 
     

    
Alig confidence 













.............
























Template Conservation     
  

 


 
.............









  
   

       
Template Sequence  RGRFATVVEELFRD. . . . . . . . . . . . . GVNWGRIVAFFEFGGVMCVESVNRE
Template Known Secondary structure  TT.............


TT
Template Predicted Secondary structure 
.............




Template SS confidence 



















































   127..130.........140 .........150.........160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions