Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADM0
Confidence2.61%DateThu Jan 5 11:21:20 GMT 2012
Rank61Aligned Residues37
% Identity24%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90.........100.........110..
Predicted Secondary structure 









Query SS confidence 



























































Query Sequence  ELLALLLCLFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVL
Query Conservation     
   
  

     
  

      
      
                      
 
Alig confidence 



















.......................
















Template Conservation 

 
 





 







.......................     
          
Template Sequence  TIIATIFMPLTFIAGIYGYP. . . . . . . . . . . . . . . . . . . . . . . VVLAVMGVIAVIMVVYF
Template Known Secondary structure  TTS


.......................TTT
Template Predicted Secondary structure  .......................
Template SS confidence 



























































   295....300.........310.... .....320.........330.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions