Return to main results Retrieve Phyre Job Id

Job DescriptionP15078
Confidence17.32%DateThu Jan 5 11:34:36 GMT 2012
Rank32Aligned Residues25
% Identity36%Templated2fug61
SCOP infoHydA/Nqo6-like HydA/Nqo6-like Nq06-like
Resolution3.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   324.....330.........340.........350.....
Predicted Secondary structure 







Query SS confidence 































Query Sequence  NLFPFLFITIACGAVSGFHALISSGTTPKMLA
Query Conservation 



 

























 
Alig confidence 








.









......





Template Conservation 


    
 .


 

   
......


 

Template Sequence  SLWPATFGL. ACCAIEMMAS. . . . . . TDAQAD
Template Known Secondary structure 






.STGGG......





Template Predicted Secondary structure 





.









......


Template SS confidence 































   35....40... ......50... ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions