Return to main results Retrieve Phyre Job Id

Job DescriptionP13016
Confidence6.11%DateThu Jan 5 11:33:25 GMT 2012
Rank62Aligned Residues31
% Identity32%Templatec2p04B_
PDB info PDB header:transferaseChain: B: PDB Molecule:signal transduction histidine kinase; PDBTitle: 2.1 ang structure of the dimerized pas domain of signal transduction2 histidine kinase from nostoc punctiforme pcc 73102 with homology to3 the h-noxa/h-noba domain of the soluble guanylyl cyclase
Resolution2.11 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80.......
Predicted Secondary structure 























Query SS confidence 


















































Query Sequence  SLPPGEFGGPWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQY
Query Conservation 
 
                                

 

 
  

 
 
 
Alig confidence 
















....................













Template Conservation   
  
 
    
  


....................





  
 
 
 
Template Sequence  APPHLTLSPELLAKAFP. . . . . . . . . . . . . . . . . . . . FHFAFSRNREIVQT
Template Known Secondary structure 







ST....................T
TT
B
Template Predicted Secondary structure 









....................




Template SS confidence 


















































   2.......10........ .20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions