Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6A6
Confidence11.25%DateThu Jan 5 11:02:42 GMT 2012
Rank35Aligned Residues38
% Identity26%Templatec3uk7B_
PDB info PDB header:transferaseChain: B: PDB Molecule:class i glutamine amidotransferase-like domain-containing PDBTitle: crystal structure of arabidopsis thaliana dj-1d
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   344.....350.........360.........370.........380.........390.........400..
Predicted Secondary structure 























Query SS confidence 


























































Query Sequence  IGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEW
Query Conservation 






   

  

 



 

   
   
 


  
       

   
  


 
Alig confidence 




.
..

















..................













Template Conservation 




.
..   
  



 

  
  ..................      
  


  
Template Sequence  VASIH. G. . QQILAAAGVLKGRKCTAY. . . . . . . . . . . . . . . . . . PAVKLNVVLGGGTW
Template Known Secondary structure 

.T..TTTTTT



..................GGGTT
Template Predicted Secondary structure  ...







..................




Template SS confidence 


























































   309310... . .....320.........330.. .......340......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions