Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6A6
Confidence17.72%DateThu Jan 5 11:02:42 GMT 2012
Rank21Aligned Residues41
% Identity10%Templatec3fseB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:two-domain protein containing dj-1/thij/pfpi-like and PDBTitle: crystal structure of a two-domain protein containing dj-1/thij/pfpi-2 like and ferritin-like domains (ava_4496) from anabaena variabilis3 atcc 29413 at 1.90 a resolution
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   343......350.........360.........370.........380.........390.........400....
Predicted Secondary structure 
























Query SS confidence 





























































Query Sequence  FIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRL
Query Conservation   






   

  

 



 

   
   
 


  
       

   
  


 
  
Alig confidence 





.
..

















..................















Template Conservation   




.
..
 


 










 ..................
    

  


 


Template Sequence  LVAAVH. G. . PQVLIEGDLLRGKQATGF. . . . . . . . . . . . . . . . . . IAISKDXXNAGADYLD
Template Known Secondary structure 

.T..TT

TT



..................GGGTT


Template Predicted Secondary structure 
...







..................





Template SS confidence 





























































   106...110. . .......120.........130 .........140......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions