Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6M4
Confidence6.42%DateThu Jan 5 11:03:33 GMT 2012
Rank66Aligned Residues33
% Identity30%Templatec2pebB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:putative dioxygenase; PDBTitle: crystal structure of a putative dioxygenase (npun_f1925) from nostoc2 punctiforme pcc 73102 at 1.46 a resolution
Resolution1.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100.........110.........120.........130.........
Predicted Secondary structure 



















Query SS confidence 














































Query Sequence  FSKGASPDRAEALYDYFVERCRQQEMNTQTGRFAADMQVSLVNDGPV
Query Conservation 
  
   
 
  

  
   

     
  
 


 
 
 
 




Alig confidence 




















.....






.........




Template Conservation 


      
  

  
   
..... 
  
  .........   

Template Sequence  YFDAASRDVAARVREGLGARF. . . . . EVQLGRW. . . . . . . . . FDKPI
Template Known Secondary structure 

TTTS.....




.........BSS

Template Predicted Secondary structure 





.....

.........




Template SS confidence 














































   16...20.........30...... ...40... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions