Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6M4
Confidence6.74%DateThu Jan 5 11:03:33 GMT 2012
Rank63Aligned Residues21
% Identity38%Templatec2dzlA_
PDB info PDB header:structural genomics unknown functionChain: A: PDB Molecule:protein fam100b; PDBTitle: solution structure of the uba domain in human protein2 fam100b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80.........90.........100........
Predicted Secondary structure 




















Query SS confidence 
































Query Sequence  VSQFTLAADTERGMRPSFSKGASPDRAEALYDY
Query Conservation 





 
   

 

 
  
   
 
  

  
Alig confidence 









............










Template Conservation 









............
 








Template Sequence  INQFVLAAGC. . . . . . . . . . . . AADQAKQLLQA
Template Known Secondary structure 

............
T
Template Predicted Secondary structure 

............
Template SS confidence 
































   21........30 .........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions