Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6M4
Confidence19.87%DateThu Jan 5 11:03:33 GMT 2012
Rank21Aligned Residues32
% Identity31%Templatec2dgaA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-glucosidase; PDBTitle: crystal structure of hexameric beta-glucosidase in wheat
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80.........90.........100.........110.........120
Predicted Secondary structure 





































Query SS confidence 



































































Query Sequence  RIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEALYDYFVERCRQQEMNT
Query Conservation 


 

 

   

 
  



 





 
   

 

 
  
   
 
  

  
   

     
Alig confidence 









....................................





















Template Conservation 

 
 
 
  ....................................
  

  
   

 
   

 
Template Sequence  RILPDGTGKV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NQAGIDYYNKLINSLIDNDIVP
Template Known Secondary structure 
TTSSSS
....................................
TT
Template Predicted Secondary structure 








....................................



Template SS confidence 



































































   108.110....... ..120.........130.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions