Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6M4
Confidence23.21%DateThu Jan 5 11:03:33 GMT 2012
Rank19Aligned Residues39
% Identity28%Templatec2dclB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:hypothetical upf0166 protein ph1503; PDBTitle: structure of ph1503 protein from pyrococcus horikoshii ot3
Resolution2.28 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80.........90.........100.........110....... ..120......
Predicted Secondary structure 





































...






Query SS confidence 



































































. . .








Query Sequence  LGYRIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEALYDYFVERCRQQE. . . MNTQTGRFA
Query Conservation 
 



 

 

   

 
  



 





 
   

 

 
  
   
 
  

  
   

   ...  
  
 

Alig confidence 













......................................















...








Template Conservation    



  
     ......................................
 

   

  
   






 


 
Template Sequence  LRLRIYIGENDKWE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRPLYKVIVEKLREMGIAGATVYRGIYG
Template Known Secondary structure  TT
T......................................TTT
S


S

Template Predicted Secondary structure 


......................................






Template SS confidence 















































































   10.........20... ......30.........40.........50.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions