Return to main results Retrieve Phyre Job Id

Job DescriptionP08622
Confidence56.48%DateThu Jan 5 11:01:33 GMT 2012
Rank65Aligned Residues30
% Identity20%Templatec2q37A_
PDB info PDB header:plant protein, lyaseChain: A: PDB Molecule:ohcu decarboxylase; PDBTitle: crystal structure of ohcu decarboxylase in the presence of2 (s)-allantoin
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30..... ....40.........50.....
Predicted Secondary structure 


...........




Query SS confidence 









. . . . . . . . . . .



















Query Sequence  KRLAMKYHPD. . . . . . . . . . . RNQGDKEAEAKFKEIKEAYE
Query Conservation 



 
 


...........

  
 

 





 



Alig confidence 









...........



















Template Conservation      
 


 

       


          
  

  
 
Template Sequence  WLEAFSAHPQIGNTPSEQSTAFATTSASALQELAEWNVLYK
Template Known Secondary structure  TS

TTS


TTTS

Template Predicted Secondary structure 










Template SS confidence 








































   51........60.........70.........80.........90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions