Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA91
Confidence38.60%DateThu Jan 5 11:12:14 GMT 2012
Rank6Aligned Residues32
% Identity31%Templatec2wkdA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:orf34p2; PDBTitle: crystal structure of a double ile-to-met mutant of protein2 orf34 from lactococcus phage p2
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100.........110.........120.........130.........140
Predicted Secondary structure 















Query SS confidence 









































Query Sequence  ADVNGFLDPVDFRGQLVTVVGPITGAVDGKIGNTPYKFMVMQ
Query Conservation 
   




  



 


 
 
 
   
 


  
 



 
Alig confidence 








....












......









Template Conservation 


   
 
....

  





  
......
 

 




Template Sequence  AFXPDFIQX. . . . GDTVTVSGRVQAK. . . . . . NYNFVFPTVE
Template Known Secondary structure 

TT

T....T

......
Template Predicted Secondary structure 





....


......





Template SS confidence 









































   47..50..... ....60........ .70........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions