Return to main results Retrieve Phyre Job Id

Job DescriptionP0CB62
Confidence20.52%DateThu Jan 5 11:30:10 GMT 2012
Rank7Aligned Residues21
% Identity38%Templated1htjf_
SCOP infoRegulator of G-protein signaling, RGS Regulator of G-protein signaling, RGS Regulator of G-protein signaling, RGS
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.... .....30.....
Predicted Secondary structure  .........
Query SS confidence 









. . . . . . . . .










Query Sequence  KRKAWLAVFL. . . . . . . . . GSALFWVVVAL
Query Conservation 









.........





 



Alig confidence 









.........










Template Conservation   








 

 

 


 




 

 
Template Sequence  SRPAHLGVFLRYIFSQADPSPLLFYLCAEV
Template Known Secondary structure 
S

Template Predicted Secondary structure 





Template SS confidence 





























   319320.........330.........340........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions