Return to main results Retrieve Phyre Job Id

Job DescriptionP0CB62
Confidence3.44%DateThu Jan 5 11:30:10 GMT 2012
Rank30Aligned Residues28
% Identity32%Templatec2wwbA_
PDB info PDB header:ribosomeChain: A: PDB Molecule:protein transport protein sec61 subunit alpha isoform 1; PDBTitle: cryo-em structure of the mammalian sec61 complex bound to the2 actively translating wheat germ 80s ribosome
Resolution6.48 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  SGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKV
Query Conservation 
 

























 



  
 
Alig confidence 














..........












Template Conservation 
 
  
     

 
..........

 
   
 



Template Sequence  PEIQKPERKIQFKEK. . . . . . . . . . VLWTAITLFIFLV
Template Known Secondary structure 










..........
Template Predicted Secondary structure 










..........
Template SS confidence 





































   17..20.........30. ........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions