Return to main results Retrieve Phyre Job Id

Job DescriptionP0CB62
Confidence1.90%DateThu Jan 5 11:30:10 GMT 2012
Rank58Aligned Residues25
% Identity20%Templatec2wwaA_
PDB info PDB header:ribosomeChain: A: PDB Molecule:sec sixty-one protein homolog; PDBTitle: cryo-em structure of idle yeast ssh1 complex bound to the2 yeast 80s ribosome
Resolution8.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.......
Predicted Secondary structure 








Query SS confidence 


































Query Sequence  SGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLI
Query Conservation 
 

























 



  
Alig confidence 














..........









Template Conservation 
 
  
     

 
..........
  
   
 
Template Sequence  PEVELPFEKLPFDDK. . . . . . . . . . IVYTIFAGLI
Template Known Secondary structure 










S..........
Template Predicted Secondary structure 










..........
Template SS confidence 


































   18.20.........30.. .......40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions