Return to main results Retrieve Phyre Job Id

Job DescriptionP0CB62
Confidence20.52%DateThu Jan 5 11:30:10 GMT 2012
Rank8Aligned Residues21
% Identity38%Templatec1htjF_
PDB info PDB header:signaling proteinChain: F: PDB Molecule:kiaa0380; PDBTitle: structure of the rgs-like domain from pdz-rhogef
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.... .....30.....
Predicted Secondary structure  .........
Query SS confidence 









. . . . . . . . .










Query Sequence  KRKAWLAVFL. . . . . . . . . GSALFWVVVAL
Query Conservation 









.........





 



Alig confidence 









.........










Template Conservation   








 

 

 


 




 

 
Template Sequence  SRPAHLGVFLRYIFSQADPSPLLFYLCAEV
Template Known Secondary structure 
S

Template Predicted Secondary structure 





Template SS confidence 





























   319320.........330.........340........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions