Return to main results Retrieve Phyre Job Id

Job DescriptionP32138
Confidence85.96%DateThu Jan 5 11:49:24 GMT 2012
Rank141Aligned Residues57
% Identity25%Templatec3n12A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:chitinase a; PDBTitle: crystal stricture of chitinase in complex with zinc atoms from2 bacillus cereus nctu2
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   316...320.........330.........340.........350.........360.........370.........380.........390.....
Predicted Secondary structure 





























Query SS confidence 















































































Query Sequence  LDSRIKQWNQEGVQFLAYINPYVASDKDLCEEAAQHGYLAKDASGGDYLVEFGEFYGGVVDLTNPEAYAWFKEVIKKNMI
Query Conservation      
  
   
 
    
 
 
        
    
  

   
               




 
  

         
Alig confidence 


















..................................


























Template Conservation      
   
  
 





..................................

   
        
  
  
 
  
 
Template Sequence  FKSDISYLKSKGKKVVLSI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GGQNGVVLLPDNAAKDRFINSIQSLID
Template Known Secondary structure  TT
..................................STT





S
Template Predicted Secondary structure 


..................................









Template SS confidence 















































































   88.90.........100...... ...110.........120.........130...
 
   396...400......
Predicted Secondary structure 




Query SS confidence 










Query Sequence  ELGCGGWMADF
Query Conservation    



   
 
Alig confidence 










Template Conservation   









Template Sequence  KYGFDGIDIDL
Template Known Secondary structure 

S
Template Predicted Secondary structure 









Template SS confidence 










   134.....140....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions