Return to main results Retrieve Phyre Job Id

Job DescriptionP32138
Confidence23.61%DateThu Jan 5 11:49:24 GMT 2012
Rank206Aligned Residues65
% Identity18%Templatec3gdbA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative uncharacterized protein spr0440; PDBTitle: crystal structure of spr0440 glycoside hydrolase domain,2 endo-d from streptococcus pneumoniae r6
Resolution1.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   313......320.........330.........340.........350.........360.........370.........380.........390..
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  YPQLDSRIKQWNQEGVQFLAYINPYVASDKDLCEEAAQHGYLAKDASGGDYLVEFGEFYGGVVDLTNPEAYAWFKEVIKK
Query Conservation 


    
  
   
 
    
 
 
        
    
  

   
               




 
  

      
Alig confidence 




.















..


























......................






Template Conservation 

   .

 






 



 ..  
              
     
   ...................... 
 


 
Template Sequence  VPTPD. VIDAGHRNGVPVYGTL. . FFNWSNSIADQERFAEALKQDADGSFP. . . . . . . . . . . . . . . . . . . . . . IARKLVD
Template Known Secondary structure  S

.TT

..

T


TTS

......................
Template Predicted Secondary structure 



.


..













......................
Template SS confidence 















































































   268.270.. .......280........ .290.........300.........310..... ....320..
 
   393......400..
Predicted Secondary structure 



Query SS confidence 









Query Sequence  NMIELGCGGW
Query Conservation       



 
Alig confidence 









Template Conservation 

  





Template Sequence  MAKYYGYDGY
Template Known Secondary structure  T

Template Predicted Secondary structure 


Template SS confidence 









   323......330..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions