Return to main results Retrieve Phyre Job Id

Job DescriptionQ6BF87
Confidence2.73%DateWed Jan 25 15:21:15 GMT 2012
Rank42Aligned Residues25
% Identity16%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.....
Predicted Secondary structure 

Query SS confidence 





























Query Sequence  FAMTFWHDLAAPILAGIITAAIVGWWRNRK
Query Conservation    
 








 


    

 
   

Alig confidence 




.....



















Template Conservation 



 .....    
          




Template Sequence  YGYPV. . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure 


.....TTTTS

Template Predicted Secondary structure  .....

Template SS confidence 





























   311.... ....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions