Return to main results Retrieve Phyre Job Id

Job DescriptionP45578
Confidence11.82%DateThu Jan 5 12:03:25 GMT 2012
Rank60Aligned Residues23
% Identity35%Templatec3by5A_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:cobalamin biosynthesis protein; PDBTitle: crystal structure of cobalamin biosynthesis protein chig from2 agrobacterium tumefaciens str. c58
Resolution2.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   81........90.........100.........110.
Predicted Secondary structure 









Query SS confidence 






























Query Sequence  MGCRTGFYMSLIGTPDEQRVADAWKAAMEDV
Query Conservation 








   
      
       
 

Alig confidence 





........
















Template Conservation 



 
........     
  

  

   
Template Sequence  IGCRKG. . . . . . . . AASDAIIAAVRAAERAF
Template Known Secondary structure 
SS........

Template Predicted Secondary structure 




........


Template SS confidence 






























   13..... .20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions