Return to main results Retrieve Phyre Job Id

Job DescriptionP31677
Confidence27.04%DateThu Jan 5 11:48:33 GMT 2012
Rank75Aligned Residues31
% Identity26%Templatec3rfxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:uronate dehydrogenase; PDBTitle: crystal structure of uronate dehydrogenase from agrobacterium2 tumefaciens, y136a mutant complexed with nad
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40..
Predicted Secondary structure 



















Query SS confidence 









































Query Sequence  MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGW
Query Conservation 
  
 


   
         


   
  
        
  
Alig confidence 






...........























Template Conservation 

 



...........



 

  
   
   
  
   
Template Sequence  MKRLLVT. . . . . . . . . . . GAAGQLGRVMRERLAPMAEILRLA
Template Known Secondary structure  ...........STTSTGGG
Template Predicted Secondary structure 

...........






Template SS confidence 









































   3...... 10.........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions