Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACY6
Confidence1.19%DateThu Jan 5 11:19:26 GMT 2012
Rank83Aligned Residues36
% Identity14%Templatec3rh3A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized duf3829-like protein; PDBTitle: crystal structure of an uncharacterized duf3829-like protein (bt_1908)2 from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.....
Predicted Secondary structure 









Query SS confidence 














































Query Sequence  LSTFFPWIEKQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKS
Query Conservation 
      
   

  






 





 


    
     
  
Alig confidence 











........




...


















Template Conservation 
  

 



 
........
  

... 


 
 

   



 
 
Template Sequence  INAVLGYXEQTG. . . . . . . . TAELL. . . DPGDYFNPEVRQNLKQNYA
Template Known Secondary structure 


........
GGGG...


TTS
Template Predicted Secondary structure 

........


...


Template SS confidence 














































   63......70.... ..... 80.........90........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions