Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADR2
Confidence2.21%DateWed Jan 25 15:20:28 GMT 2012
Rank34Aligned Residues21
% Identity24%Templatec2kluA_
PDB info PDB header:immune system, membrane proteinChain: A: PDB Molecule:t-cell surface glycoprotein cd4; PDBTitle: nmr structure of the transmembrane and cytoplasmic domains2 of human cd4
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80....
Predicted Secondary structure 





Query SS confidence 































Query Sequence  AILGLAVAMQRRISIWFYWSSVFLALGTVLFS
Query Conservation 


 
              
  
   
  


Alig confidence 







...........












Template Conservation 


 

  ...........
 


  
  

 
Template Sequence  ALIVLGGV. . . . . . . . . . . AGLLLFIGLGIFF
Template Known Secondary structure  ...........
Template Predicted Secondary structure 
...........
Template SS confidence 































   373......380 .........390...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions