Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADR2
Confidence4.85%DateWed Jan 25 15:20:28 GMT 2012
Rank12Aligned Residues22
% Identity32%Templatec2jo1A_
PDB info PDB header:hydrolase regulatorChain: A: PDB Molecule:phospholemman; PDBTitle: structure of the na,k-atpase regulatory protein fxyd1 in2 micelles
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.........70.........80..
Predicted Secondary structure 





Query SS confidence 

































Query Sequence  FHTLAILGLAVAMQRRISIWFYWSSVFLALGTVL
Query Conservation   





 
              
  
   
  
Alig confidence 









............











Template Conservation 
 







............ 
 








Template Sequence  YQSLQIGGLV. . . . . . . . . . . . IAGILFILGILI
Template Known Secondary structure  T............
Template Predicted Secondary structure 
............
Template SS confidence 

































   13......20.. .......30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions