Return to main results Retrieve Phyre Job Id

Job DescriptionP27838
Confidence3.60%DateThu Jan 5 11:44:15 GMT 2012
Rank86Aligned Residues33
% Identity27%Templatec2w56B_
PDB info PDB header:unknown functionChain: B: PDB Molecule:vc0508; PDBTitle: structure of the hypothetical protein vc0508 from vibrio cholerae2 vsp-ii pathogenicity island
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.........70
Predicted Secondary structure 





















Query SS confidence 



























































Query Sequence  DQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYH
Query Conservation 
  
  
   

      
 
 
   




        




 
  









  
Alig confidence 












.............










..............








Template Conservation    
  

   
  .............  






 
..............



 



Template Sequence  KKLHKLLSEQLTA. . . . . . . . . . . . . HYLVFNFRDKS. . . . . . . . . . . . . . YSADEGGFH
Template Known Secondary structure  .............


TT..............
BTTTB


Template Predicted Secondary structure 


.............



..............






Template SS confidence 



























































   15....20....... ..30........ .40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions