Return to main results Retrieve Phyre Job Id

Job DescriptionP27838
Confidence12.38%DateThu Jan 5 11:44:15 GMT 2012
Rank18Aligned Residues37
% Identity19%Templatec2v1lA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:hypothetical protein; PDBTitle: structure of the conserved hypothetical protein vc1805 from2 pathogenicity island vpi-2 of vibrio cholerae o1 biovar3 eltor str. n16961 shares structural homology with the4 human p32 protein
Resolution2.13 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50.........60.........70
Predicted Secondary structure 





















Query SS confidence 





























































Query Sequence  LADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQVWLATKQGGYH
Query Conservation   

  
  
   

      
 
 
   




        




 
  









  
Alig confidence 














...........












..............








Template Conservation 

  
  

   
  ...........    






 
..............



 

 
Template Sequence  ISKPFHALLANILSE. . . . . . . . . . . HQAEVVMNFRDSS. . . . . . . . . . . . . . YSAEDGGFH
Template Known Secondary structure 

...........


TT..............
BTTTB


Template Predicted Secondary structure 



...........





..............






Template SS confidence 





























































   13......20....... ..30.........40 .........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions