Return to main results Retrieve Phyre Job Id

Job DescriptionP27838
Confidence32.15%DateThu Jan 5 11:44:15 GMT 2012
Rank6Aligned Residues23
% Identity43%Templatec1q40C_
PDB info PDB header:translationChain: C: PDB Molecule:mrna transport regulator mtr2; PDBTitle: crystal structure of the c. albicans mtr2-mex67 m domain complex
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50...... ...60.....
Predicted Secondary structure 






...........

Query SS confidence 













. . . . . . . . . . .








Query Sequence  FENGSKIIINRQEP. . . . . . . . . . . LHQVWLATK
Query Conservation         




 
...........  






Alig confidence 













...........








Template Conservation 
     



 


          

   
 

 
Template Sequence  LKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTP
Template Known Secondary structure  TT



SS

TS
Template Predicted Secondary structure 

















Template SS confidence 

































   46...50.........60.........70.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions