Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence25.08%DateThu Jan 5 11:49:29 GMT 2012
Rank103Aligned Residues30
% Identity37%Templated2afhe1
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nitrogenase iron protein-like
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30......... 40.........50........
Predicted Secondary structure 
















.....



Query SS confidence 






































. . . . .


















Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGG. . . . . PAATAAVAAARLGAQVDFI
Query Conservation 
 


 

   

                        

.....   
 
  
  

      
Alig confidence 







...
.........................

.....


















Template Conservation 

 


 
...
.........................








 


  

  
 




Template Sequence  MRQCAIYG. . . K. . . . . . . . . . . . . . . . . . . . . . . . . GGIGKSTTTQNLVAALAEMGKKVMIV
Template Known Secondary structure 
...
.........................TTSSTT

Template Predicted Secondary structure 


...
.........................







Template SS confidence 






























































   2....... 10 .........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions