Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence51.53%DateThu Jan 5 11:49:29 GMT 2012
Rank78Aligned Residues30
% Identity17%Templated1n1ea2
SCOP infoNAD(P)-binding Rossmann-fold domains NAD(P)-binding Rossmann-fold domains 6-phosphogluconate dehydrogenase-like, N-terminal domain
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50........
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFI
Query Conservation 
 


 

   

                        

   
 
  
  

      
Alig confidence 








............................




















Template Conservation 
 

 


 ............................
 

   
  
   
  
 
 
Template Sequence  LNKAVVFGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . GAFGTALAMVLSKKCREVCVW
Template Known Secondary structure 

............................STT
Template Predicted Secondary structure 

............................



Template SS confidence 

























































   15....20... ......30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions