Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence58.20%DateThu Jan 5 11:49:29 GMT 2012
Rank73Aligned Residues30
% Identity37%Templatec3kd9B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:coenzyme a disulfide reductase; PDBTitle: crystal structure of pyridine nucleotide disulfide oxidoreductase from2 pyrococcus horikoshii
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50. .......
Predicted Secondary structure 

















..


Query SS confidence 


















































. .






Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARL. . GAQVDFI
Query Conservation 
 


 

   

                        

   
 
  
  
..
      
Alig confidence 








............................













..






Template Conservation 








............................
 


 

  
        
 

Template Sequence  LKKVVIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GAAGMSAASRVKRLKPEWDVKVF
Template Known Secondary structure 



............................S
TTS
Template Predicted Secondary structure 



............................




Template SS confidence 



























































   3......10. ........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions