Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence23.66%DateThu Jan 5 11:49:29 GMT 2012
Rank107Aligned Residues30
% Identity43%Templatec3ic9D_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:dihydrolipoamide dehydrogenase; PDBTitle: the structure of dihydrolipoamide dehydrogenase from colwellia2 psychrerythraea 34h.
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50........
Predicted Secondary structure 

..


















Query SS confidence 


. .






















































Query Sequence  MIR. . VACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFI
Query Conservation 
 
..

 

   

                        

   
 
  
  

      
Alig confidence 


..





............................




















Template Conservation 

 







............................
 


 

  

  
  



Template Sequence  VINVDVAIIGT. . . . . . . . . . . . . . . . . . . . . . . . . . . . GTAGXGAYRAAKKHTDKVVLI
Template Known Secondary structure 

............................STT
S
Template Predicted Secondary structure 






............................



Template SS confidence 



























































   3......10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions