Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence39.24%DateThu Jan 5 11:49:29 GMT 2012
Rank88Aligned Residues30
% Identity23%Templatec3dojA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:dehydrogenase-like protein; PDBTitle: structure of glyoxylate reductase 1 from arabidopsis2 (atglyr1)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50........
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFI
Query Conservation 
 


 

   

                        

   
 
  
  

      
Alig confidence 








............................




















Template Conservation 



 



............................
 

  

  
   
  
   
Template Sequence  MMEVGFLGL. . . . . . . . . . . . . . . . . . . . . . . . . . . . GIMGKAMSMNLLKNGFKVTVW
Template Known Secondary structure  S


............................STT
Template Predicted Secondary structure 



............................



Template SS confidence 

























































   0........ .10.........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions