Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence72.68%DateThu Jan 5 11:49:29 GMT 2012
Rank69Aligned Residues32
% Identity19%Templatec3dhnA_
PDB info PDB header:isomerase, lyaseChain: A: PDB Molecule:nad-dependent epimerase/dehydratase; PDBTitle: crystal structure of the putative epimerase q89z24_bactn2 from bacteroides thetaiotaomicron. northeast structural3 genomics consortium target btr310.
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........
Predicted Secondary structure 




















Query SS confidence 


























































Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIG
Query Conservation 
 


 

   

                        

   
 
  
  

       
Alig confidence 









...........................





















Template Conservation 









...........................
 

  

  
   
  
    
Template Sequence  VKKIVLIGAS. . . . . . . . . . . . . . . . . . . . . . . . . . . GFVGSALLNEALNRGFEVTAVV
Template Known Secondary structure 

T

...........................TTT

Template Predicted Secondary structure 




...........................



Template SS confidence 


























































   4.....10... ......20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions