Return to main results Retrieve Phyre Job Id

Job DescriptionP32143
Confidence32.64%DateThu Jan 5 11:49:29 GMT 2012
Rank94Aligned Residues30
% Identity43%Templatec1xdiA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:rv3303c-lpda; PDBTitle: crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Resolution2.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50. .......
Predicted Secondary structure 

















...


Query SS confidence 


















































. . .






Query Sequence  MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARL. . . GAQVDFI
Query Conservation 
 


 

   

                        

   
 
  
  
...
      
Alig confidence 








............................













...






Template Conservation 
 






............................
 





  


    
  



Template Sequence  VTRIVILGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGYEAALVAATSHPETTQVTVI
Template Known Secondary structure 


............................S
TTT
Template Predicted Secondary structure 



............................






Template SS confidence 




























































   2.......10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions